PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34323.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 473aa    MW: 54063.6 Da    PI: 6.5866
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34323.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-18193239148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed ll+++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
       KHN34323.1 193 KGQWTSDEDRLLIQLVEQFGVRKWSHIAQALP-GRIGKQCRERWHNHL 239
                      799*****************************.*************97 PP

2Myb_DNA-binding59.67e-19245287145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+eEd++l++a+++ G++ W+ Ia++++ gRt++++k++w+
       KHN34323.1 245 KDTWTEEEDKILIQAHAEIGNK-WAEIAKKLP-GRTENSIKNHWN 287
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.067188243IPR017930Myb domain
SuperFamilySSF466893.46E-32190286IPR009057Homeodomain-like
SMARTSM007171.0E-16192241IPR001005SANT/Myb domain
PfamPF002491.3E-16193239IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-29194247IPR009057Homeodomain-like
CDDcd001671.91E-15196239No hitNo description
PROSITE profilePS5129422.672244294IPR017930Myb domain
SMARTSM007175.6E-18244292IPR001005SANT/Myb domain
PfamPF002491.9E-17245287IPR001005SANT/Myb domain
CDDcd001672.95E-14247290No hitNo description
Gene3DG3DSA:1.10.10.607.7E-23248292IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MDIETNLTEN CASQSQPMDL HENYLKPSME DQLPFGTPST QGFLQDFHHI DHQFHVNGSS  60
SSNPIFGVQT PNFDPFDQNV TCESAPPDFE AYECKPLAES NGIGHAHLMN NFQYAGYSLN  120
LPRTNQLDLM VANQSYMTFN ALETKPLNFV VPDEVSCISP PNYYKRVGLN KNLRESPSTR  180
RTFKARKKSN IVKGQWTSDE DRLLIQLVEQ FGVRKWSHIA QALPGRIGKQ CRERWHNHLR  240
PDIKKDTWTE EEDKILIQAH AEIGNKWAEI AKKLPGRTEN SIKNHWNATK RRQYSKRKCR  300
SKYPRGSLLQ EYIKSLNLDK NPPIDYRKKS AKNANANTNS NGKAAAQPQC SDQFCLNSQM  360
VPRYDFNEVP DFCLDDNLFE EGCSIDSLLD DMQSASTMDE KGFDEKIMQC APTMEGKQSH  420
QGGMQCVHVV DVDVHHETEM MAHTNGIEVK KELDFVEMMS HMNGNHYSIH SPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-461912932104C-Myb DNA-Binding Domain
1msf_C3e-461912932104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283310.0EU028331.1 Glycine max clone BAC gmw1-89M01 genomic sequence.
GenBankEU0283320.0EU028332.1 Glycine max clone BAC gmw2-77P21 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525506.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-94MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0B2RQ030.0A0A0B2RQ03_GLYSO; Transcription factor MYB98
STRINGGLYMA05G02300.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-93myb domain protein 98
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]